PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g088180.2.1
Common NameLOC101250466
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 320aa    MW: 36312 Da    PI: 6.9825
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g088180.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.45.3e-57161411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL++kv ++ + +  +i evd++kvePwdLp k+k +ekewyfF+ rdkky+tg+r+nrat++gyWkatgkdke
  Solyc02g088180.2.1  16 LPPGFRFHPTDEELITHYLAPKVLDSGFCA-IAIGEVDLNKVEPWDLPWKAKMGEKEWYFFCMRDKKYPTGQRTNRATEAGYWKATGKDKE 105
                         79*************************888.78***************888999************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ +++lvg+kktLvfykgrap+gekt+Wvmheyrl
  Solyc02g088180.2.1 106 IFK-SKTLVGMKKTLVFYKGRAPRGEKTNWVMHEYRL 141
                         ***.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-6313166IPR003441NAC domain
PROSITE profilePS5100558.59416166IPR003441NAC domain
PfamPF023651.2E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEIVCGFGGR EEEMELPPGF RFHPTDEELI THYLAPKVLD SGFCAIAIGE VDLNKVEPWD  60
LPWKAKMGEK EWYFFCMRDK KYPTGQRTNR ATEAGYWKAT GKDKEIFKSK TLVGMKKTLV  120
FYKGRAPRGE KTNWVMHEYR LDGKYSIHNL PKTAKNECVI CRIFKKNSGG KKIAISNLTR  180
SDSITDNSRS SNLPPLMDLS PYNKITTTAR SSGETCNSHV TCFSDSMEDQ KPQTYDHHHL  240
LSSSPVSVDF PQNVPNDSMT YMGNFQYGDS GLMQDNSIMR LLIDNNYGSE SKQSLRGYED  300
HDINISSTGP VDIDCLWNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-531317214171NAC domain-containing protein 19
4dul_A2e-531317214171NAC domain-containing protein 19
1ut7_B2e-531317214171NO APICAL MERISTEM PROTEIN
1ut7_A2e-531317214171NO APICAL MERISTEM PROTEIN
1ut4_B2e-531317214171NO APICAL MERISTEM PROTEIN
1ut4_A2e-531317214171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.254090.0seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232213.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-122NC100_ARATH; NAC domain-containing protein 100
TrEMBLK4BBX40.0K4BBX4_SOLLC; NAC2-domain containing protein
STRINGSolyc02g088180.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-124NAC domain containing protein 100
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]